You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579887 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NOX1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NOX1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 65 kDa |
Target | NOX1 |
UniProt ID | Q9Y5S8 |
Protein Sequence | Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF |
NCBI | NP_008983 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MOX1, NOH1, NOH-1, GP91-2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts were loaded per well using 12% SDS-PAGE. Membrane was incubated with 3 ug/ml of antibody.
Host: Rabbit, Target Name: NOX1, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: NOX1, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
NOX1 antibody - C-terminal region (orb579887) validated by WB using Epithelial Colorectal Adenocarcinoma CaCO2 at 1:10.
WB Suggested Anti-NOX1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, ICC, IF, IHC-P | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating