NOVA2 antibody

• Catalog Number: orb577564
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NOVA2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOVA2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: NOVA2
• UniProt ID: Q9UNW9
• Protein Sequence: Synthetic peptide located within the following region: MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK
• NCBI: NP_002507
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ANOVA, NOVA3, NEDASB, NOVA-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1. 10 ug human neural cell lysate, 2. 10 ug human non-neural cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit IRDye 800 (1hr room temperature), Secondary Antibody Dilution: 1:15000, Gene Name: NOVA2.

WB Suggested Anti-NOVA2 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.