You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329684 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NOTCH4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NOTCH4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 61kDa |
Target | NOTCH4 |
UniProt ID | Q99466 |
Protein Sequence | Synthetic peptide located within the following region: LLLGLGAARELRDQAGLAPADVAHQRNHWDLLTLLEGAGPPEARHKATPG |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti INT3 antibody, anti NOTCH4 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Jurkat cell lysate tissue using NOTCH4 antibody
Immunohistochemical staining of human Breast tissue using NOTCH4 antibody
Host: Rabbit, Target Name: NOTCH4, Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.
Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0 ug/mL using anti-NOTCH4 antibody (orb329684).
WB Suggested Anti-NOTCH4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating