You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577744 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NONO |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, IHC-P, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NONO |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52kDa |
Target | NONO |
UniProt ID | Q15233 |
Protein Sequence | Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
NCBI | NP_031389 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
Human Liver
NONO was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb577744 with 1:200 dilution. Western blot was performed using orb577744 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: NONO IP with orb577744 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.
Rabbit Anti-NONO Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-NONO Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Sample Type: subnuclear bodies-paraspeckles.
WB Suggested Anti-NONO Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
FC, ICC, IF, IHC, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating