Cart summary

You have no items in your shopping cart.

    non-muscle Myosin IIB/MYH10 Antibody

    Catalog Number: orb654443

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb654443
    CategoryAntibodies
    Descriptionnon-muscle Myosin IIB/MYH10 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human non-muscle Myosin IIB/MYH10 (QRTGLEDPERYLFVDRAVIYNPATQADWTAKK).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW229 kDa
    UniProt IDP35580
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    non-muscle Myosin IIB/MYH10 Antibody

    Western blot analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (orb654443). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat brain tissue lysates, Lane 2: mouse brain tissue lysates, Lane 3: mouse NIH/3T3 whole cell lysates, Lane 4: human SKOV3 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-non-muscle Myosin IIB/MYH10 antigen affinity purified polyclonal antibody (Catalog # orb654443) at 0.25 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for non-muscle Myosin IIB/MYH10 at approximately 229KD. The expected band size for non-muscle Myosin IIB/MYH10 is at 229KD.

    non-muscle Myosin IIB/MYH10 Antibody

    IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (orb654443). non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (orb654443) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    non-muscle Myosin IIB/MYH10 Antibody

    IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (orb654443). non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (orb654443) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    non-muscle Myosin IIB/MYH10 Antibody

    IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (orb654443). non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (orb654443) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    non-muscle Myosin IIB/MYH10 Antibody

    IF analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (orb654443). non-muscle Myosin IIB/MYH10 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (orb90553) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 4μg/mL rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (orb654443) overnight at 4°C. DyLight?594 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

    non-muscle Myosin IIB/MYH10 Antibody

    Flow Cytometry analysis of A431 cells using anti-non-muscle Myosin IIB/MYH10 antibody (orb654443). Overlay histogram showing A431 cells stained with orb654443 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (orb654443, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    non-muscle Myosin IIB/MYH10 Antibody

    Flow Cytometry analysis of ANA-1 cells using anti-non-muscle Myosin IIB/MYH10 antibody (orb654443). Overlay histogram showing ANA-1 cells stained with orb654443 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (orb654443, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    non-muscle Myosin IIB/MYH10 Antibody

    Flow Cytometry analysis of C6 cells using anti-non-muscle Myosin IIB/MYH10 antibody (orb654443). Overlay histogram showing C6 cells stained with orb654443 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (orb654443, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    • Myosin-10 antibody [orb1421314]

      ICC,  IF,  IHC-Fr,  IHC-P

      Bovine, Porcine, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars