You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579675 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NOLC1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Reactivity | Human, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NOLC1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | NOLC1 |
UniProt ID | Q14978 |
Protein Sequence | Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ |
NCBI | NP_004732 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P130, Srp40, NOPP130, NOPP140, NS5ATP13 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
Immunohistochemistry with pFa fixed zebrafish kidney tissue at an antibody concentration of 0.004 using anti-NOLC1 antibody (orb579675).
NOLC1 antibody - C-terminal region (orb579675) validated by WB using HepG2 cell lysate at 2.5 ug/ml. NOLC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
ELISA, IHC, WB | |
Canine, Drosophila, Human, Mouse, Plant, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating