You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325280 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NNAT |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NNAT |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 6 |
Target | NNAT |
UniProt ID | Q16517 |
Protein Sequence | Synthetic peptide located within the following region: MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ |
NCBI | NP_859017 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC1439 antibody, anti Peg5 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: NNAT, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-NNAT Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.
ICC, IF, IHC-Fr, IHC-P | |
Bovine, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating