NNAT antibody

• Catalog Number: orb325280
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NNAT
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NNAT
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 6
• Target: NNAT
• UniProt ID: Q16517
• Protein Sequence: Synthetic peptide located within the following region: MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ
• NCBI: NP_859017
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC1439 antibody, anti Peg5 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: NNAT, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-NNAT Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.