NMUR2 antibody

• Catalog Number: orb575438
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NMUR2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NMUR2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: NMUR2
• UniProt ID: Q9GZQ4
• Protein Sequence: Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV
• NCBI: NP_064552
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FM4, FM-4, TGR1, NMU2R, TGR-1, NMU-R2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: NMUR2, Positive control (+): Mouse Testis (M-TE), Negative control (-): Mouse Heart (M-HE), Antibody concentration: 1 ug/ml.

WB Suggested Anti-NMUR2 Antibody, Titration: 2.5 ug/ml, Positive Control: HepG2 Whole Cell.