Cart summary

You have no items in your shopping cart.

    nmt55/p54nrb/NONO Antibody

    Catalog Number: orb334608

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb334608
    CategoryAntibodies
    Descriptionnmt55/p54nrb/NONO Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    Predicted ReactivityBovine
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW54232 MW
    UniProt IDQ15233
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesNon-POU domain-containing octamer-binding protein;
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    nmt55/p54nrb/NONO Antibody

    Flow Cytometry analysis of HELA cells using anti-nmt55/p54nrb antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    nmt55/p54nrb/NONO Antibody

    WB analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody.Lane 1:human HeLa cell; 2:human A549 cell; 3:human SW620 cell; 4:human PANC-1 cell; 5:human U20S cell; 6:rat lung tissue;7:mouse lung tissue.

    nmt55/p54nrb/NONO Antibody

    IF analysis of nmt55/p54nrbusing anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human colon cancer tissue.

    nmt55/p54nrb/NONO Antibody

    IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in immunocytochemical section of U20S cells.

    nmt55/p54nrb/NONO Antibody

    IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in immunocytochemical section of SKOV-3 cells.

    nmt55/p54nrb/NONO Antibody

    IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of mouse brain tissue.

    nmt55/p54nrb/NONO Antibody

    IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human lung cancer tissue.

    nmt55/p54nrb/NONO Antibody

    IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human intestinal cancer tissue.

    nmt55/p54nrb/NONO Antibody

    IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human lung cancer tissue.

    nmt55/p54nrb/NONO Antibody

    IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human mammary cancer tissue.

    nmt55/p54nrb/NONO Antibody

    IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of rat intestine tissue.

    • nmt55 p54nrb NONO Antibody (monoclonal, 11E2) [orb507553]

      FC,  ICC,  IF,  WB

      Human

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars