You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334608 |
---|---|
Category | Antibodies |
Description | nmt55/p54nrb/NONO Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 54232 MW |
UniProt ID | Q15233 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Non-POU domain-containing octamer-binding protein; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HELA cells using anti-nmt55/p54nrb antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody.Lane 1:human HeLa cell; 2:human A549 cell; 3:human SW620 cell; 4:human PANC-1 cell; 5:human U20S cell; 6:rat lung tissue;7:mouse lung tissue.
IF analysis of nmt55/p54nrbusing anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human colon cancer tissue.
IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in immunocytochemical section of U20S cells.
IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in immunocytochemical section of SKOV-3 cells.
IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of human mammary cancer tissue.
IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody. nmt55/p54nrb was detected in paraffin-embedded section of rat intestine tissue.
FC, ICC, IF, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating