nmt55 p54nrb NONO Antibody (monoclonal, 11E2)

• Catalog Number: orb507553
• Category: Antibodies
• Description: nmt55 p54nrb NONO Antibody (monoclonal, 11E2)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 11E2
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55 p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 60 kDa
• UniProt ID: Q15233
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Non-POU domain-containing octamer-binding protein;
• Note: For research use only
• Application notes: Western blot, 0.1-0.5μg/ml Immunocytochemistry, 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 5μg/ml Flow Cytometry, 1-3μg/1x10^6 cells
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-nmt55 p54nrb antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody.Lane 1:human HELA cell; 2:human placenta tissue; 3:human MCF-7 cell; 4:human A549 cell; 5:human SW620 cell; 6:human PANC-1 cell; 7:human U20S cell; 8:human K562 cell.

IF analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody. nmt55 p54nrb was detected in immunocytochemical section of MCF-7 cells.

IHC analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody.nmt55 p54nrb was detected in immunocytochemical section of A431 cell.