Nme1 antibody

• Catalog Number: orb576557
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Nme1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: DOT, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Yeast
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: Nme1
• UniProt ID: P15532
• Protein Sequence: Synthetic peptide located within the following region: NVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEIS
• NCBI: NP_032730
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NDP, NM23A, NDPK-A, NM23-M, NM23-M1, AL024257
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DB Suggested Anti-Nme1 antibody, Titration: 0.5 ug/ml, Positive Control: Recomninant human NME2 protein.

Lanes: 1. 20 ug human MDA-MB-231 cell lysate, 2. 20 ug murine 4T1 primary breast tumor cell lysate, 3. 20 ug human MDA-MB-231 cell lysate, 4. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: Nme1.

WB Suggested Anti-Nme1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.