You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb315127 |
---|---|
Category | Antibodies |
Description | NM23A/NME1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 17149 MW |
UniProt ID | P15531 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Nucleoside diphosphate kinase A;NDK A;NDP kinase A Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U251 cells using anti-NME1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of HeLa cells using anti-NME1 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Western blot analysis using Anti-NM23A antibody.Lane 1:Rat Brain Tissue;2:Rat Liver Tissue;3:HELA Cell;4:NIH3T3 Cell.
FC, ICC, IHC, IHC-Fr, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating