You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583852 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NKX3-2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NKX3-2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35 kDa |
Target | NKX3-2 |
UniProt ID | P78367 |
Protein Sequence | Synthetic peptide located within the following region: GAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQR |
NCBI | NP_001180 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SMMD, BAPX1, NKX3B, NKX3.2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: NKX3-2, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: NKX3-2, Positive control (+): 293T (2T), Negative control (-): Stomach tumor (T-ST), Antibody concentration: 1 ug/ml.
WB Suggested Anti-NKX3-2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating