Nkx2-5 antibody

• Catalog Number: orb573852
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Nkx2-5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human Nkx2-5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: Nkx2-5
• UniProt ID: P52952
• Protein Sequence: Synthetic peptide located within the following region: ELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVE
• NCBI: NP_004378
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSX, CSX1, VSD3, CHNG5, HLHS2, NKX2E, NKX2.5, NKX4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: NKX2-5, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Rabbit Anti-NKX2-5 Antibody, Catalog Number: orb573852, Formalin Fixed Paraffin Embedded Tissue: Human Heart Muscle Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Nkx2-5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.