NKX2-2 antibody

• Catalog Number: orb574147
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NKX2-2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKX2-2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: NKX2-2
• UniProt ID: O95096
• Protein Sequence: Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ
• NCBI: NP_002500
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NKX2B, NKX2.2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: NKX2-2, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: NKX2-2, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage CellsPrimary, dilution: IHC-PZ 1:500, IHC-P 1:1000.

WB Suggested Anti-NKX2-2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Spleen.