You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334639 |
---|---|
Category | Antibodies |
Description | NIRF/UHRF2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 89985 MW |
UniProt ID | Q96PU4 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | E3 ubiquitin-protein ligase UHRF2;6.3.2.-;Np95/ICB Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of NIRF using anti-NIRF antibody.Lane 1:rat testis tissue; 2:K562 cell.
IHC analysis of NIRF using anti-NIRF antibody. NIRF was detected in a paraffin-embedded section of mouse intestine tissue.
IHC analysis of NIRF using anti-NIRF antibody. NIRF was detected in a paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of NIRF using anti-NIRF antibody. NIRF was detected in a paraffin-embedded section of rat intestine tissue.
Filter by Rating