You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb412978 |
---|---|
Category | Antibodies |
Description | Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 60 kDa |
UniProt ID | P32297 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Neuronal acetylcholine receptor subunit alpha-3; C Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U251 cells using anti-CHRNA3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U-87 cells using anti-CHRNA3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of CHRNA3 using anti-CHRNA3 antibody.Lane 1:human HeLa cell;2:human MDA-MB-453 cell;3:human Jurkat cell;4:human HepG2 cell;5:human SK-OV-3 cell;6:human PANC-1 cell;7:mouse thymus tissue.
ELISA, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating