NFKBIB antibody

• Catalog Number: orb575059
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFKBIB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFKBIB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: NFKBIB
• UniProt ID: Q15653
• Protein Sequence: Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL
• NCBI: NP_002494
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IKBB, TRIP9
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: NFKBIB, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: NFKBIB, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: NFKBIB, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 100 ug mouse liver lysate, Lane 2: 100 ug mouse brain lysate, Lane 3: 100 ug mouse heart lysate, Lane 4: 100 ug mouse kidney lysate, Lane 5: 100 ug mouse lung lysate, Lane 6: 100 ug mouse thymus lysate, Lane 7: 100 ug mouse spleen lysate, Lane 8: 100 ug mouse testis lysate, Lane 9: 100 ug HeLa cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-AP, Secondary Antibody dilution: 1:10000, Gene Name: NFKBIB.

WB Suggested Anti-NFKBIB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Jurkat cell lysate, NFKBIB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.