NFKB2 antibody

• Catalog Number: orb574027
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFKB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NFKB2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 97kDa
• Target: NFKB2
• UniProt ID: Q00653
• Protein Sequence: Synthetic peptide located within the following region: SDSDSDSEGPEKDTRSSFRGHTPLDLTCSTLVKTLLLNAAQNTMEPPL
• NCBI: NP_002493
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: p52, p100, H2TF1, LYT10, CVID10, LYT-10, NF-kB2, p
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: NFKB2, Sample Tissue: Human HCT116, Antibody dilution: 1.0 ug/ml.

Human Muscle

Human Smooth Muscle

WB Suggested Anti-NFKB2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.