NFIC antibody

• Catalog Number: orb592965
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFIC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFIC
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: NFIC
• UniProt ID: Q6FI30
• Protein Sequence: Synthetic peptide located within the following region: KSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSIL
• NCBI: NP_995315
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CTF, NFI, CTF5, NF-I
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: NFIC, Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Human Adipocytes

Immunohistochemistry with Human Adipocytes tissue.

WB Suggested Anti-NFIC Antibody Titration: 1 ug/ml, Positive Control: MCF-7 whole cell lysates.