NFIA Antibody

• Catalog Number: orb381082
• Category: Antibodies
• Description: NFIA Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Gallus, Hamster, Monkey, Rabbit
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55944 MW
• UniProt ID: Q12857
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Nuclear factor 1 A-type;NF1-A;Nuclear factor 1/A;C
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of K562 cells using anti-NFIA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of SiHa cells using anti-NFIA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of NFIA using anti-NFIA antibody.Lane 1:JURKAT cell;2:COLO320 cell.

WB analysis of NFIA using anti-NFIA antibody.Lane 1:mouse HEPA1-6 cell;2:mouse SP2/0 cell.

IHC analysis of NFIA using anti-NFIA antibody.NFIA was detected in paraffin-embedded section of mouse liver tissues.

IHC analysis of NFIA using anti-NFIA antibody.NFIA was detected in paraffin-embedded section of rat liver tissues.

IHC analysis of NFIA using anti-NFIA antibody.NFIA was detected in paraffin-embedded section of human mammary cancer tissues.