Cart summary

You have no items in your shopping cart.

    NFIA Antibody (monoclonal, 16H11)

    Catalog Number: orb527055

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb527055
    CategoryAntibodies
    DescriptionNFIA Antibody (monoclonal, 16H11)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number16H11
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman
    IsotypeMouse IgG2b
    ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW62 kDa
    UniProt IDQ12857
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesNuclear factor 1 A-type; NF1-A; Nuclear factor 1/A
    Read more...
    NoteFor research use only
    Application notesAdd 0.2ml of distilled water will yield a concentration of 500μg/ml.
    Expiration Date12 months from date of receipt.
    NFIA Antibody (monoclonal, 16H11)

    Flow Cytometry analysis of U20S cells using anti-NFIA antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

    NFIA Antibody (monoclonal, 16H11)

    WB analysis of NFIA using anti-NFIA antibody.Lane 1:human HeLa cell;2:human HEK293 cell.

    NFIA Antibody (monoclonal, 16H11)

    IF analysis of NFIA using anti-NFIA antibody. NFIA was detected in immunocytochemical section of A431 cells.

    NFIA Antibody (monoclonal, 16H11)

    IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human intestinal cancer tissue.

    NFIA Antibody (monoclonal, 16H11)

    IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human intestinal cancer tissue.

    NFIA Antibody (monoclonal, 16H11)

    IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human tonsil tissue.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars