You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592964 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NFATC3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 115kDa |
Target | NFATC3 |
UniProt ID | B5B2S0 |
Protein Sequence | Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
NCBI | NP_004546 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NFAT4, NFATX, NF-AT4c Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: NFATC3, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: NFATC3, Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Host: Mouse, Target Name: NFATC3, Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.
Immunohistochemistry with Thymus tissue at an antibody concentration of 5 ug/ml using anti-NFATC3 antibody (orb592964).
Rabbit Anti-NFATC3 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-NFATC3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.
ELISA, FC, ICC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating