NFATC1 antibody

• Catalog Number: orb592967
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFATC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Guinea pig, Mouse
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78kDa
• Target: NFATC1
• UniProt ID: O95644
• Protein Sequence: Synthetic peptide located within the following region: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASS
• NCBI: NP_765978
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NFAT2, NFATc, NF-ATC, NF-ATc1.2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-NFATC1 Antibody, Catalog Number: orb592967, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic in bile ducts and in sinusoids not in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-NFATC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Stomach.

WB Suggested Anti-NFATC1 antibody Titration: 1 ug/ml, Sample Type: Human liver.