You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584466 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NETO1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NETO1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60kDa |
Target | NETO1 |
UniProt ID | Q8R4I7 |
Protein Sequence | Synthetic peptide located within the following region: MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI |
NCBI | NP_620416 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BCTL1, BTCL1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target: NETO1, Positive control (+): Human Brain (BR), Negative control (-): HeLa cell lysate (HL), Antibody concentration: 1 ug/ml.
Immunohistochemistry with mice retinal neurons tissue at an antibody concentration of researcher doesn't say using anti-NETO1 antibody (orb584466).
WB Suggested Anti-NETO1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Gallus, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating