You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330290 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NEDD4L |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NEDD4L |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 110 kDa |
Target | NEDD4L |
UniProt ID | Q96PU5 |
Protein Sequence | Synthetic peptide located within the following region: TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP |
NCBI | NP_056092 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ33870 antibody, anti KIAA0439 antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human cystic fibrosis epithelial tissue using NEDD4L antibody
Western blot analysis of PANC1 cell lysate tissue using NEDD4L antibody
Host: Rabbit, Target Name: NEDD4L, Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/mL.
Human cystic fibrosis epithelial.
WB Suggested Anti-NEDD4L Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating