NEDD4L antibody

• Catalog Number: orb330290
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NEDD4L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NEDD4L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 110 kDa
• Target: NEDD4L
• UniProt ID: Q96PU5
• Protein Sequence: Synthetic peptide located within the following region: TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP
• NCBI: NP_056092
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ33870 antibody, anti KIAA0439 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human cystic fibrosis epithelial tissue using NEDD4L antibody

Western blot analysis of PANC1 cell lysate tissue using NEDD4L antibody

Host: Rabbit, Target Name: NEDD4L, Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/mL.

Human cystic fibrosis epithelial.

WB Suggested Anti-NEDD4L Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate.