Ndufb8 Rabbit Polyclonal Antibody

• Catalog Number: orb579812
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Ndufb8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 22kDa
• Target: Ndufb8
• UniProt ID: Q9D6J5
• Protein Sequence: Synthetic peptide located within the following region: KHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEP
• NCBI: NP_080337
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CI-ASHI, AI987932, 2900010I05Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Ndufb8 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.