Cart summary

You have no items in your shopping cart.

    NDUAD antibody

    Catalog Number: orb327376

    DispatchUsually dispatched within 1 - 2 weeks
    $ 572.00
    Catalog Numberorb327376
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to NDUAD
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityHuman
    ReactivityHuman
    ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUAD
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW15kDa
    TargetNDUFA13
    UniProt IDQ9P0J0
    Protein SequenceSynthetic peptide located within the following region: MPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRR
    NCBINP_057049
    StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesanti NDUFA13 antibody, anti GRIM19 antibody, anti
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    NDUAD antibody

    Host: Rabbit, Target Name: NDUAD, Sample Tissue: Human A549, Antibody Dilution: 1.0 ug/mL.

    NDUAD antibody

    Host: Rabbit, Target Name: NDUAD, Sample Type: Fetal Kidney lysates, Antibody Dilution: 1.0 ug/mL.

    NDUAD antibody

    Host: Rabbit, Target Name: NDUFA13, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

    NDUAD antibody

    Host: Rabbit, Target Name: NDUFA13, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

    NDUAD antibody

    Host: Rabbit, Target Name: NDUFA13, Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 3 ug/mL.

    NDUAD antibody

    Host: Rabbit, Target Name: NDUFA13, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

    • NDUAD antibody [orb772741]

      ELISA,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      50ul, 100ul
    • NDUFA13 Peptide - N-terminal region [orb2002183]

      15kDa

      100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars