Cart summary

You have no items in your shopping cart.

    NDRG4 Peptide - middle region

    NDRG4 Peptide - middle region

    Catalog Number: orb1999743

    DispatchUsually dispatched within 5-10 working days
    $ 269.00
    Catalog Numberorb1999743
    CategoryProteins
    DescriptionNDRG4 Peptide - middle region
    Predicted ReactivityHuman
    Form/AppearanceLyophilized powder
    MW38 kDa
    UniProt IDQ9ULP0
    Protein SequenceSynthetic peptide located within the following region: QANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVV
    NCBINP_001123959.1
    StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
    Buffer/PreservativesLyophilized powder
    Alternative namesBDM1, SMAP8, SMAP-8
    Read more...
    NoteFor research use only
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars