You have no items in your shopping cart.
Cart summary
NDPK Protein, S. cerevisiae, Recombinant (E. coli, His)
Catalog Number: orb1976470
| Catalog Number | orb1976470 |
|---|---|
| Category | Proteins |
| Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage. NDPK Protein, S. cerevisiae, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.2 kDa and the accession number is P36010. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 21.2 kDa (predicted) |
| UniProt ID | P36010 |
| Protein Sequence | MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE |
| Expression System | E. coli |
| Biological Origin | Saccharomyces cerevisiae |
| Biological Activity | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage. NDPK Protein, S. cerevisiae, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.2 kDa and the accession number is P36010. |
| Expression Region | 1-153 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
