You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574233 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NCOA3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NCOA3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 155kDa |
Target | NCOA3 |
UniProt ID | Q0VF45 |
Protein Sequence | Synthetic peptide located within the following region: DQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLL |
NCBI | NP_006525 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ACTR, AIB1, RAC3, SRC3, pCIP, AIB-1, CTG26, SRC-3, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: NCOA3, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. NCOA3 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0 ug/ml using anti-NCOA3 antibody (orb574233).
WB Suggested Anti-NCOA3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
IH, WB | |
Human, Mouse, Primate | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating