You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584361 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Nckipsd |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Human, Mouse, Rabbit |
Reactivity | Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nckipsd |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | Nckipsd |
Protein Sequence | Synthetic peptide located within the following region: LPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEDVIRCYLEELLH |
NCBI | NP_001100327 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: Nckipsd, Sample Type: Rat Pancreas lysates, Antibody dilution: 1.0 ug/ml.
IHC-P | |
Bovine, Porcine, Rabbit, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating