You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580662 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NAT8L |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 15kDa |
Target | NAT8L |
UniProt ID | Q8N9F0 |
Protein Sequence | Synthetic peptide located within the following region: VAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE |
NCBI | NP_848652 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CML3, NACED, NAT8-LIKE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-NAT8L Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating