You have no items in your shopping cart.
Cart summary
Nanog Recombinant Protein
Catalog Number: orb1495087
| Catalog Number | orb1495087 |
|---|---|
| Category | Proteins |
| Description | Nanog Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~40kDa |
| UniProt ID | Q9H9S0 |
| Solubility (25°C) | 0.5M Urea, PH7.4 |
| Protein Sequence | HMSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVLE |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | 0.5M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human NANOG protein [orb358465]
Greater than 90% as determined by SDS-PAGE.
36.6 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgHuman NANOG protein [orb358341]
Greater than 90% as determined by SDS-PAGE.
50.6 kDa
E.coli
20 μg, 100 μg, 1 mgHuman NANOG protein [orb605165]
Greater than 85% as determined by SDS-PAGE.
39.6 kDa
E.coli
100 μg, 20 μg, 1 mgNanog-TAT Recombinant Protein [orb1230590]
Greater than 95% by SDS-PAGE gel and HPLC analyses.
E. coli
0.02 mg, 0.005 mgNanog Recombinant Protein [orb1230968]
Greater than 95% by SDS-PAGE gel and HPLC analyses.Endotoxin level is less than 0.1 ng per μg (1EU/μg).
E. coli
0.02 mg, 0.005 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
