NADSYN1 antibody

• Catalog Number: orb326642
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NADSYN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NADSYN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78kDa
• Target: NADSYN1
• UniProt ID: Q6IA69
• Protein Sequence: Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG
• NCBI: NP_060631
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ10631 antibody, anti FLJ36703 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: NADSYN1, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: NADSYN1, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: NADSYN1, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Host: Rabbit, Target Name: NADSYN1, Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: NADSYN1, Sample Type: PANC1 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target: NADSYN1, Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 3 ug/mL.