You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316600 |
---|---|
Category | Antibodies |
Description | Myosin Phosphatase/PPP1R12A Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Gallus, Rabbit |
Reactivity | Human, Monkey, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 115281 MW |
UniProt ID | O14974 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Protein phosphatase 1 regulatory subunit 12A;Myosi Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HeLa cells using anti-PPP1R12A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U251 cells using anti-PPP1R12A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of SiHa cells using anti-PPP1R12A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of PPP1R12A using anti-PPP1R12A antibody.Lane 1:human HELA cell; 2:human Jurkat cell; 3:human HEK293 cell; 4:monkey COS-7 cell; 5:human Raji cell; 6:human K562 cell; 7:human CACO-2 cell; 8:human HEPG2 cell.
WB analysis of PPP1R12A using anti-PPP1R12A antibody.Lane 1:rat brain tissue; 2:rat lung tissue; 3:rat liver tissue; 4:rat C6 cell; 5:mouse brain tissue; 6:mouse lung tissue; 7:mouse liver tissue; 8:mouse NIH/3T3 cell.
IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in paraffin-embedded section of Human Glioma Tissue.
IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of U251 cell.
IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of SiHa cell.
IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of U251 cell.
IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of U251 cell.
IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of U251 cell.
FC, ICC, IF, WB | |
Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating