MYOF antibody

• Catalog Number: orb325305
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYOF
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 235 kDa
• Target: MYOF
• UniProt ID: Q9NZM1
• Protein Sequence: Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
• NCBI: NP_038479
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ36571 antibody, anti FLJ90777 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: MYOF, Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, MYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Host: Rabbit, Target Name: MYOF, Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, MYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Host: Rabbit, Target Name: MYOF, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: MYOF, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: MYOF, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: MYOF, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7.