You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325305 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MYOF |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 235 kDa |
Target | MYOF |
UniProt ID | Q9NZM1 |
Protein Sequence | Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM |
NCBI | NP_038479 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ36571 antibody, anti FLJ90777 antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.
Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: MYOF, Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, MYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: MYOF, Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, MYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: MYOF, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: MYOF, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: MYOF, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: MYOF, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Filter by Rating