You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583680 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MYL6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Zebrafish |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MYL6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 17 kDa |
Target | MYL6 |
UniProt ID | P60660 |
Protein Sequence | Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT |
NCBI | NP_524147 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LC17, ESMLC, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Protein may be acetylated and/or phosphorylated.
25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.
Human Prostate
Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-MYL6 antibody (orb583680).
WB Suggested Anti-MYL6 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. MYL6 is supported by BioGPS gene expression data to be expressed in HepG2.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating