MYL6 Rabbit Polyclonal Antibody

• Catalog Number: orb583679
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYL6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYL6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: MYL6
• UniProt ID: P60660
• Protein Sequence: Synthetic peptide located within the following region: CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV
• NCBI: NP_524147
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LC17, ESMLC, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-MYL6 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MYL6 Antibody orb583679 concentration 5 ug/ml.

Anti-MYL6 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MYL6 Antibody orb583679 concentration 5 ug/ml.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. MYL6 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-MYL6 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. MYL6 is supported by BioGPS gene expression data to be expressed in HepG2.