You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583679 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MYL6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MYL6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 17kDa |
Target | MYL6 |
UniProt ID | P60660 |
Protein Sequence | Synthetic peptide located within the following region: CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV |
NCBI | NP_524147 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LC17, ESMLC, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Anti-MYL6 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MYL6 Antibody orb583679 concentration 5 ug/ml.
Anti-MYL6 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MYL6 Antibody orb583679 concentration 5 ug/ml.
Host: Rabbit, Target Name: MYL6, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. MYL6 is supported by BioGPS gene expression data to be expressed in 721_B.
WB Suggested Anti-MYL6 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. MYL6 is supported by BioGPS gene expression data to be expressed in HepG2.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating