MYL2 monoclonal antibody (M01), clone 3B9-B4

• Catalog Number: orb2292547
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant MYL2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B9-B4
• Tested applications: ELISA, IF, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: MYL2 (AAH15821.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
• NCBI: AAH15821.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MYL2 is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MYL2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of MYL2 transfected lysate using anti-MYL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MYL2 MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (44 KDa).