You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578409 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MYH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MYH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 223 kDa |
Target | MYH1 |
UniProt ID | P12882 |
Protein Sequence | Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK |
NCBI | NP_005954 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MYHa, HEL71, MYHSA1, MyHC-2x, MyHC-2X/D Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: MYH1, Sample Tissue: Human OVCAR-3, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: MYH1, Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/ml. MYH1 is supported by BioGPS gene expression data to be expressed in OVCAR3.
Rabbit Anti-MYH1 Antibody, Catalog Number: orb578409, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-MYH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating