MYEF2 antibody

• Catalog Number: orb324427
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYEF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYEF2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: MYEF2
• UniProt ID: Q9P2K5
• Protein Sequence: Synthetic peptide located within the following region: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG
• NCBI: NP_057216
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MEF-2 antibody, anti MST156 antibody, anti MS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Lung tissue using MYEF2 antibody

Western blot analysis of Jurkat cell lysate tissue using MYEF2 antibody

Immunohistochemical staining of human Lung tissue using MYEF2 antibody

Human Lung

Host: Mouse, Target Name: MYEF2, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: MYEF2, Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-MYEF2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.