MYBBP1A antibody

• Catalog Number: orb576248
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYBBP1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Guinea pig, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse MYBBP1A
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 148kDa
• Target: MYBBP1A
• UniProt ID: Q7TPV4
• Protein Sequence: Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
• NCBI: NP_058056
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU01
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Mouse Kidney

Mouse Lung

WB Suggested Anti-MYBBP1A Antibody Titration: 1.25 ug/ml, Positive Control: SP2/0 cell lysate.