You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576248 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MYBBP1A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Guinea pig, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse MYBBP1A |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 148kDa |
Target | MYBBP1A |
UniProt ID | Q7TPV4 |
Protein Sequence | Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP |
NCBI | NP_058056 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU01 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Mouse Kidney
Mouse Lung
WB Suggested Anti-MYBBP1A Antibody Titration: 1.25 ug/ml, Positive Control: SP2/0 cell lysate.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating