MXI1 antibody

• Catalog Number: orb573783
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MXI1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MXI1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26kDa
• Target: MXI1
• UniProt ID: P50539
• Protein Sequence: Synthetic peptide located within the following region: LNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
• NCBI: NP_569157
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MXI, MAD2, MXD2, bHLHc11
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Host: Mouse, Target Name: MXI1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target: MXI1, Positive control (+): Mouse Brain (M-BR), Negative control (-): Mouse Kidney (M-KI), Antibody concentration: 3 ug/ml.

IHC Suggested Anti-MXI1 antibody, Titration: 5 ug/ml, Positive Control: Lung, respiratory epithelium.

Rabbit Anti-MXI1 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Epithelial cells of bronchiole, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-MXI1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.