You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb19089 |
---|---|
Category | Antibodies |
Description | Musashi 1/Msi1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 39125 MW |
UniProt ID | O43347 |
RRID | AB_10746493 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | RNA-binding protein Musashi homolog 1;Musashi-1;MS Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of CACO-2 cells using anti-Musashi 1/Msi1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.
WB analysis of Musashi 1/Msi1 using anti-Musashi 1/Msi1 antibody.Lane 1:human 293T cell; 2:human T-47D cell; 3:human Colo320 cell; 4:rat brain tissue; 5:mouse brain tissue.
IF analysis of Musashi 1/Msi1 using anti-Musashi 1/Msi1 antibody. Musashi 1/Msi1 was detected in an immunocytochemical section of MCF7 cells.
IHC analysis of Musashi 1/Msi1 using anti-Musashi 1/Msi1 antibody. Musashi 1/Msi1 was detected in paraffin-embedded section of human lung cancer tissues.
IHC analysis of Musashi 1/Msi1 using anti-Musashi 1/Msi1 antibody. Musashi 1/Msi1 was detected in paraffin-embedded section of mouse intestine tissues.
IHC analysis of Musashi 1/Msi1 using anti-Musashi 1/Msi1 antibody. Musashi 1/Msi1 was detected in paraffin-embedded section of rat intestine tissues.
IHC analysis of Musashi 1/Msi1 using anti-Musashi 1/Msi1 antibody. Musashi 1/Msi1 was detected in paraffin-embedded section of rat brain tissues.
IHC analysis of Musashi 1/Msi1 using anti-Musashi 1/Msi1 antibody. Musashi 1/Msi1 was detected in paraffin-embedded section of human mammary cancer tissues.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
FC, ICC, IHC-P | |
Bovine, Canine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating