You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb623779 |
---|---|
Category | Antibodies |
Description | Musashi 1/Msi1 Antibody (monoclonal, 2B9) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2B9 |
Tested applications | ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Mouse IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 39 kDa |
UniProt ID | O43347 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Msi 1; Msi1 ; Musashi-1; Musashi1 Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
IF analysis of MSI using anti-MSI antibody.
MSI was detected in paraffin-embedded section of human rectum cancer tissue.
IHC analysis of MSI using anti-MSI antibody.
WB analysis using anti-MSI antibody.Lane 1:A549 tissue, Lane 2:PC-3 cell.
Filter by Rating