Cart summary

You have no items in your shopping cart.

    Musashi 1/Msi1 Antibody (monoclonal, 2B9)

    Catalog Number: orb623779

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb623779
    CategoryAntibodies
    DescriptionMusashi 1/Msi1 Antibody (monoclonal, 2B9)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number2B9
    Tested applicationsICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeMouse IgG2b
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW39 kDa
    UniProt IDO43347
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesMsi 1; Msi1 ; Musashi-1; Musashi1
    Read more...
    NoteFor research use only
    Application notesAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Musashi 1/Msi1 Antibody (monoclonal, 2B9)

    IF analysis of MSI using anti-MSI antibody.

    Musashi 1/Msi1 Antibody (monoclonal, 2B9)

    MSI was detected in paraffin-embedded section of human rectum cancer tissue.

    Musashi 1/Msi1 Antibody (monoclonal, 2B9)

    IHC analysis of MSI using anti-MSI antibody.

    Musashi 1/Msi1 Antibody (monoclonal, 2B9)

    WB analysis using anti-MSI antibody.Lane 1:A549 tissue, Lane 2:PC-3 cell.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars