You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331131 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MUS81 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 61kDa |
Target | MUS81 |
UniProt ID | Q96NY9 |
Protein Sequence | Synthetic peptide located within the following region: GETRGGGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGE |
NCBI | NP_079404 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ21012 antibody, anti FLJ44872 antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: Lane 1: 20 ug 293T cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: MUS81.
WB Suggested Anti-MUS81 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating