You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334551 |
---|---|
Category | Antibodies |
Description | Munc18-1/STXBP1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 67569 MW |
UniProt ID | P61764 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Syntaxin-binding protein 1;MUNC18-1;N-Sec1;Protein Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A549 cells using anti-STXBP1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.
WB analysis of STXBP1 using anti-STXBP1 antibody.Lane 1:human HeLa cell; 2:rat brain tissue; 3:rat C6 cell; 4:mouse brain tissue.
IF analysis of STXBP1 using anti-STXBP1 antibody. STXBP1 was detected in an immunocytochemical section of HeLa cells.
IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of mouse brain tissue.
IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of rat brain tissue.
IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of human glioma tissue.
Filter by Rating