Cart summary

You have no items in your shopping cart.

    Munc18-1/STXBP1 Antibody

    Catalog Number: orb334551

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb334551
    CategoryAntibodies
    DescriptionMunc18-1/STXBP1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW67569 MW
    UniProt IDP61764
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesSyntaxin-binding protein 1;MUNC18-1;N-Sec1;Protein
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Munc18-1/STXBP1 Antibody

    Flow Cytometry analysis of A549 cells using anti-STXBP1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

    Munc18-1/STXBP1 Antibody

    WB analysis of STXBP1 using anti-STXBP1 antibody.Lane 1:human HeLa cell; 2:rat brain tissue; 3:rat C6 cell; 4:mouse brain tissue.

    Munc18-1/STXBP1 Antibody

    IF analysis of STXBP1 using anti-STXBP1 antibody. STXBP1 was detected in an immunocytochemical section of HeLa cells.

    Munc18-1/STXBP1 Antibody

    IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of mouse brain tissue.

    Munc18-1/STXBP1 Antibody

    IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of rat brain tissue.

    Munc18-1/STXBP1 Antibody

    IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of human glioma tissue.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars