You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820821 |
---|---|
Category | Proteins |
Description | The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)) (Gene ID: 100303676). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 7.5 kDa |
Target | IGF-2 |
Entrez | 100303676 |
Protein Sequence | YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67) |
Protein Length | 67 |
Source | Yeast |
Storage | -20°C |
Alternative names | Somatomedin A Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating