MUL1 antibody

• Catalog Number: orb325073
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MUL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf166
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40 kDa
• Target: MUL1
• UniProt ID: Q969V5
• Protein Sequence: Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
• NCBI: NP_078820
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ12875 antibody, anti RP11-401M16.2 antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL ug/mL of the antibody was used in this experiment. 40 kDa band likely has ubiquitin crosslinks and smaller isoforms of 34 kDa and 28 kDa also contain this peptide sequence.

Host: Rabbit, Target Name: C1orf166, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: MUL1, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: MUL1, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: MUL1, Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: MUL1, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target: MUL1, Positive control (+): Human kidney (KI), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL.

WB Suggested Anti-C1orf166 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.